![Master giving freshly brewed tea to guest during ceremony at table, closeup Photo of Master giving freshly brewed tea to guest during ceremony at table, closeup](https://static.africaimages.com/photos/K/d/KdUqSx4sTQOXFj0syjYTI79ir/KdUqSx4sTQOXFj0syjYTI79ir_normal.jpg)
Master giving freshly brewed tea to guest during ceremony at table, closeup
Stock Photo ID: 726580
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Master giving freshly brewed tea to guest during ceremony at table, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 6 May 2021
You may use our image “Master giving freshly brewed tea to guest during ceremony at table, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultantiqueasiaasianbackgroundbeveragebowlbrewbrewedceramicceremonychawanchinachinesecloseupculturecupdrinkeastfemalefreshfreshlygivinggongfugreenguesthandhealthhealthyherbalholdinghotindoorsjapanjapaneselifestylemasternaturalofferingorganicorientalpeoplerelaxserviceservingtableteatraditionalwomanwomen
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
High-quality stock photos can be transformative across industries
High-quality stock photos can play a significant role in meeting visual demands in various industries, from advertising and web design to journalism and marketing. They have the power to capture the essence of a brand and effectively convey messages, and evoke emotions. Our royalty-free images enable content creators and business owners alike to discover high-resolution pictures and illustrations that perfectly align with their project’s needs. Not only will you be able to find cost-effective and unique pictures that fit your creative vision, but ones that also adhere to the licensing and usage rights associated with the image.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.