Many different fresh vegetables as background, closeup
Stock Photo ID: 471398
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Many different fresh vegetables as background, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 11 Jul 2019
You may use our image “Many different fresh vegetables as background, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
abundanceagricultureassortedavocadobackdropbackgroundbellcloseupcollectioncookingcropculinarydeliciousdietdifferenteatingeggplantfarmfoodfreshfruitgastronomygrocerygroupharvesthealthymanymarketmealnaturalnutrientnutritionobjectonionorganicpepperproductrawripesaleshopstoresupermarkettastyvarietyveganvegetablesvegetarianvitaminswallpaper
Elevate your brand awareness with Africa Images’ stock photography
A subsidiary project of Africa Studio, Africa Images is distinctive by its ability to produce powerful visuals. We created something unique and inspiring in 2008 by combining an innovative stock photography approach with exceptional service performance. Our image library has collections for many trending and popular topics and is suitable for both commercial as well as non-commercial projects. These royalty-free images are an invaluable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content. We can be a key partner in improving the impact of your marketing and advertisements by enhancing your brand’s creative output.
Let us provide royalty-free visual investments for your brand
High-resolution stock photos exist so that content creators and businesses can easily find an image that’s already available, offering convenience and saving time, resources, and money. Once an image is downloaded from the website, you will have access to it immediately, which means no waiting for post-production editing before you can start to use your photo. This is just one of the many features and benefits of our service to elevate your brand’s creative output and appeal. These royalty-free photos are an invaluable resource and investment for designers, business owners, teachers, bloggers, and marketers wanting to produce high-quality, professional content.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.