Man and woman holding hands on white background, closeup. Help and support concept
Stock Photo ID: 329357
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Man and woman holding hands on white background, closeup. Help and support concept”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 27 Nov 2018
You may use our image “Man and woman holding hands on white background, closeup. Help and support concept” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
assistancebackgroundbondingbusinesscarecharitycloseupcompassionconceptcoupledonateempathyfemalefriendshipgivinggripguidehandhandshealthhelphelpingholdinghopeisolatedlifelovemalemanmercypatientpeopleproblemsprotectionpsychologistpullingrescuerespectsocialstrengthsupportteamteamworktogethertouchingtrustunityvolunteerwhitewoman
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Develop a responsible stock photo strategy for your brand
Understanding stock photos and how to use them responsibly doesn’t need to be confusing. Stock images, such as those on our website, have already been taken, edited and are ready to use. We then make them available for licensing, meaning content creators and businesses pay a fee to get the right to use the image in your designs and creative projects legally. With royalty-free images, this gives you a wide range of usage rights over one stock image for a cost-effective price. For both commercial and non-commercial projects, consider us as your visual partner in responsibly bolstering your creative output and sales.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.