
Man and woman holding hands on grey background, closeup. Help and support concept
Stock Photo ID: 331074
Large 5604 × 3840 px, JPG 197.7 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Man and woman holding hands on grey background, closeup. Help and support concept”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5604 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 27 Nov 2018
You may use our image “Man and woman holding hands on grey background, closeup. Help and support concept” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
assistancebackgroundbondingbusinesscarecharitycloseupcompassionconceptcoupledonateempathyfemalefriendshipgivinggraspgreygripguidehandhandshealthhelphelpingholdinghopelifelovemalemanmercypatientpeopleproblemsprotectionpsychologistpullingrescuerespectsocialstrengthsupportteamteamworktogethertouchingtrustunityvolunteerwoman
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Get trending photos, free pictures, blog content, and more with us
Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.