
Luxury perfume in bottle on fabric with shiny sequins, closeup
Stock Photo ID: 1703820
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Luxury perfume in bottle on fabric with shiny sequins, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Mar 2024
You may use our image “Luxury perfume in bottle on fabric with shiny sequins, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticbackgroundbeautifulbeautybottlecarecloseupcolognecontainercopycosmeticdesignelegantfabricfashionfemalefragrancefragrantfreshnessfruitygiftglamourglasshealthhygienelidliquidluxurymockupobjectodourpackagingperfumeperfumerypleasantproductscentsequinsshinysilversmellspacespraysweettexttoilettetransparentwomen
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Shape your brand narratives with high-resolution stock photos
In a well-planned marketing campaign, imagery can play a crucial role in telling your brand’s story. It provides those all-important visual clues to both existing and new customers, which will help them align with your business and understand how it could fit into their lives. With the potential to evoke specific emotions, stock images can be a powerful way to build strong customer relationships and convey your brand’s story. The variety and quality of photos available at Africa Images will help to get your point across quickly while saving time and money, helping to increase conversions and provide a richer customer experience.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.