
Luxury perfume in bottle on fabric with shiny sequins
Stock Photo ID: 1703816
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Luxury perfume in bottle on fabric with shiny sequins”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Mar 2024
You may use our image “Luxury perfume in bottle on fabric with shiny sequins” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticbackgroundbeautifulbeautybottlecarecloseupcolognecontainercopycosmeticdesignelegantfabricfashionfemalefloralfragrancefragrantfreshnessgiftglamourglasshealthhygieneliquidluxurymockupobjectodourpackagingperfumeperfumerypinkpleasantproductscentsequinsshinysilversmellspacespraysweettexttoilettetransparentwomen
Africa Images: stay relevant and up to date with the latest trends
At Africa Images, we pride ourselves on offering content creators the latest and most unique stock photos and visual services. Our daily updated image collections, which include trending and popular materials, are ideal for both commercial and non-commercial projects. If you are in marketing, advertising, or communications, these royalty-free pictures can improve your campaigns by raising brand awareness and driving sales. By monitoring and staying up to date with the latest trends, and offering a range of sizes and resolutions, we guarantee that with our distinct images, your company will stand out from its competitors and leave a lasting impression on your audience.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Find diverse stock image collections to elevate your work
Regardless of what industry you are in, our platform has diverse images that cover all kinds of everyday activities and even specialist subjects. Explore the hottest topics and trending themes in popular categories including interiors, home decor, salons, spas, food, drinks, and much more. When you browse on a selected category, you will find photo collections grouped by the same theme. With our convenient filters and keyword functionality, you can refine your results using our search page. We guarantee you will find the perfect picture in one of our quality collections that matches with your idea or specific campaign.
Get trending photos, free pictures, blog content, and more with us
Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a pleasant shopping experience on our easy-to-use site
Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.