Lovely couple with hot drinks spending time together on city street
Stock Photo ID: 1584696
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Lovely couple with hot drinks spending time together on city street”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 8 Jan 2024
You may use our image “Lovely couple with hot drinks spending time together on city street” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundbeautifulblurredbokehboyfriendcaucasianchristmascitycouplecutedatedaydecemberdrinkseffectfamilyfemalegirlgirlfriendhappinesshappyholidayhothusbandlightslovelovelymalemannewoutdoorspeopleportraitrelationshipromanticseasonsmilesmilingspendingstreettimetogetherwifewinterwintertimewomanxmasyearyoung
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
Stock photographs can create a visual impact across industries
The correct use of visuals in business matters when it comes to the online environment. Amidst the constant information overloading and dwindling attention spans, businesses need to create unique ways through which they can catch and keep capturing the audience’s attention. We are proud to provide high-quality stock images, which include a variety of topics, themes, styles, and moods that help set the tone and build a connection between you and your audience. Irrespective of what industry you belong to, whether it is financial services, the cosmetics industry, or environmental studies, the ideal stock image can play a huge role in the interest and consideration of prospect customers.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Revitalize your visual content with the latest stock images
Your go-to online photo stock provides the perfect place for you to immerse yourself in creativity. Enjoy a constant flow of fresh content, including a collection of unique photos not available elsewhere. We also have a huge free image gallery covering an array of topics whereas our blog gives you invaluable ideas, tactics, and techniques on how to use stock imagery for business and creative growth. These additional benefits and features of our service make us a popular choice for content creators and business owners alike to upgrade both commercial and non-commercial projects. Reap the rewards of using our site today and enjoy amazing new content for your campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.