Lovely couple having picnic in park on sunny spring day
Stock Photo ID: 719972
Large 4353 × 6385 px, JPG 153.56 × 225.25 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Lovely couple having picnic in park on sunny spring day”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4353 × 6385 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 27 Apr 2021
You may use our image “Lovely couple having picnic in park on sunny spring day” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultalcoholbackgroundbasketboyfriendcaucasiancoupledatedaydinnerdrinkfamilyfemaleflowersfungirlfriendglassesgrassguitarhappinesshappyhavinglifestylelovelovelylunchmalemanmusicnatureoutdoorsoutsideparkpeoplepicnicromanticsakuraserenadesittingsmilingsongspringspringtimesunnytogethervacationweekendwinewomanyoung
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Develop a responsible stock photo strategy for your brand
Understanding stock photos and how to use them responsibly doesn’t need to be confusing. Stock images, such as those on our website, have already been taken, edited and are ready to use. We then make them available for licensing, meaning content creators and businesses pay a fee to get the right to use the image in your designs and creative projects legally. With royalty-free images, this gives you a wide range of usage rights over one stock image for a cost-effective price. For both commercial and non-commercial projects, consider us as your visual partner in responsibly bolstering your creative output and sales.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.