Little daughter kissing and congratulating her mom with Mother`s Day at home. Woman holding bouquet of beautiful tulips
Stock Photo ID: 1735153
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Little daughter kissing and congratulating her mom with Mother`s Day at home. Woman holding bouquet of beautiful tulips”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 20 Feb 2024
You may use our image “Little daughter kissing and congratulating her mom with Mother`s Day at home. Woman holding bouquet of beautiful tulips” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
8adultbackgroundbeautifulbirthdaybondingbouquetcaucasiancelebratecelebrationchildcongratulatingcongratulationdaughterdayeventfamilyfemalefestiveflowersgiftgirlgivinggreetinghappyholdingholidayhomeindoorsinternationalkidkissinglifestylelittlelovemarchmaymommommymothermotherhoodparentpeoplepreschoolerpresentsmilingspringsurprisetulipswoman
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Download inspiring visuals from our extensive image collections
Explore the creativity behind the selection process for our diverse stock photo categories. From the everyday existence images through to one-off events and celebrations, you will also find popular and trending themed collections including aspirational interior design, soothing spas, wanderlust holidays and travel, healthy fresh foods, and so much more. These varied categories are regularly reviewed and updated by our team, ensuring they are current, inspiring and keep your brand efforts fresh and effective. Every single picture is a carefully crafted and styled work of art, expertly selected for your satisfaction above and beyond the expectation of a photo stock.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s secure and simple to find your ideal image on our website
Don’t you hate when you waste precious time searching online for stock images only to find the quality, user experience, payment processing, and poor customer service? That’s not the case with our photo stock. Alongside diverse image collections, easy website navigation, and payment protection at checkout, our on-demand pack options provide choices depending on your usage needs and, most importantly, cost savings when buying in bulk. Both the Standard and Extended licenses allow for our visual content to be used in digital reproductions, as well as personal non-commercial use. With Extended, you benefit from unlimited use in printed reproductions and outdoor advertising. You can also use this license type if you’re involved in designing business or commercial spaces, as well as in products for sale or distribution and digital templates for sale or distribution.