Little children in Santa hats making craftworks at table indoors. Christmas season
Stock Photo ID: 539452
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Little children in Santa hats making craftworks at table indoors. Christmas season”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 3 Sep 2019
You may use our image “Little children in Santa hats making craftworks at table indoors. Christmas season” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbeautifulbokehboybrothercaucasiancelebrationchildchildrenchristmasconceptcraftcraftworkscreativecutedrawingfriendsgirlhandmadehappyhatsholidayhomehouseindoorsjoykidletterlightslittlemagicmailmakingmerrynewpeopleprimarysantaschoolseasonsistersmallsmilingtabletraditionaltreewinterx-masxmasyear
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Let us provide royalty-free visual investments for your brand
High-resolution stock photos exist so that content creators and businesses can easily find an image that’s already available, offering convenience and saving time, resources, and money. Once an image is downloaded from the website, you will have access to it immediately, which means no waiting for post-production editing before you can start to use your photo. This is just one of the many features and benefits of our service to elevate your brand’s creative output and appeal. These royalty-free photos are an invaluable resource and investment for designers, business owners, teachers, bloggers, and marketers wanting to produce high-quality, professional content.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Get additional benefits beyond quality images with our photo stock
Have a taste of innovation with our premium and trusted online photo stock. Creative professionals can stay up to date with the latest trends and popular themes thanks to new images loaded daily on the platform. Filter and download your perfect picture from our free gallery that covers diverse topics, including business, transport, fashion, and much more. In our blog, you will discover best practices in using your new high-resolution stock images in business and creative activities. Choose us for additional services that will elevate your visual experience, going beyond the norm to deliver outstanding results for you and your brand.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We offer flexible pricing plans to help you craft visual excellence
When it comes to finding not only the best quality but affordable images, we are the photo stock of choice. We offer cost-effective on-demand pricing plans that don't break the bank. Priced from only $5 per high-resolution image on our Standard license and a bulk saving when you purchase 10 images for $25, this will give you the opportunity to save in the long run and have more photos available when you need them for your upcoming campaigns. From browsing our collections for your desired pictures to purchasing and downloading them, we have made the process as smooth and as enjoyable as possible for the ultimate buyer experience.