Kitchen appliances on table against blurred background
Stock Photo ID: 210074
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Kitchen appliances on table against blurred background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 25 May 2018
You may use our image “Kitchen appliances on table against blurred background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
applianceappliancesarrangementbackgroundblenderblurredcleancoffeecollectioncontemporarycookcookerycookingcounterdesigndetaildevicedifferentdomesticelectricelectricalelementequipmentfoodholdhomehousehouseholdindoorsinterioritemskitchenlifestylemachinemakermetalnewnobodyobjectsetstainlesssteeltabletoasterutensil
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Encounter a world of special imagery with our popular photo stock
Your visuals will always be cutting-edge with our fast-moving online photo stock. Relish fresh and original content accompanied by a free image gallery with over 100 pages covering different themes and topics, including sports, cosmetics, food, fashion, and much more. Take a read of our inspiring blog posts, where we offer handy hints and tips that can be used in business and creative campaigns to boost the power of stock images. So, if you are looking for high-quality images to enhance either your commercial or non-commercial projects, along with added benefits and service features, you have come to the right place.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From payment to download, experience a seamless online journey
As a leading online supplier of stock images, users can experience great customer satisfaction from start to finish when it comes to downloading their chosen pictures. The process of finding exactly what you are looking for and comparing the different license plans available results in an enhanced purchase interaction. You can choose from a Standard or Extended on-demand pack depending on how you plan to use your new downloads. Both options also provide savings when purchasing in bulk. So not only is this more cost-effective but it means you can bank these additional photos for future use in your work initiatives.