
Interior of modern makeup room
Stock Photo ID: 179128
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Interior of modern makeup room”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 12 Mar 2018
You may use our image “Interior of modern makeup room” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
armchairartistbackgroundbackstagebeauticianbeautybrushescomfortablecontemporarycopycosmeticscottoncozydecordecorativedesigndetaildressingelementfashionflowersfurnitureglamourhomeindoorsinteriorlamplifestylelightlipstickmakemakeupmirrormodernprofessionalreflectionroomsalonspacestudiostylestylisttabletexttoolstrendtrendyupvisagewindow
Elevate your brand awareness with Africa Images’ stock photography
A subsidiary project of Africa Studio, Africa Images is distinctive by its ability to produce powerful visuals. We created something unique and inspiring in 2008 by combining an innovative stock photography approach with exceptional service performance. Our image library has collections for many trending and popular topics and is suitable for both commercial as well as non-commercial projects. These royalty-free images are an invaluable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content. We can be a key partner in improving the impact of your marketing and advertisements by enhancing your brand’s creative output.
Let your content showcase the emotive power of stock images
Content building is one of the most important aspects of today’s marketing and communication in an almost exclusively digital world. Regardless of the type of content, whether it is social media posts, blog posts, website content or even presentations, the visual impact of these materials is crucial to gain the audience’s attention. With time, stock photos have increased in popularity, becoming an effective way of improving the quality and power of content, as well as being educational, engaging, and entertaining. We have images to suit the visual style of your brand, helping to create the desired emotions and response from your target audience.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.