
Interior of contemporary apartment with stylish furniture
Stock Photo ID: 746527
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Interior of contemporary apartment with stylish furniture”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 13 Jun 2021
You may use our image “Interior of contemporary apartment with stylish furniture” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
apartmentbackgroundbeautifulblanketbouquetcarpetceilingcomfortcontemporarycouchcozycupcushiondecordesigndomesticdrinkelegantelementestatefashionflatflowersfreshfurniturehomehouseideaindoorinteriorkitchenlamplifestylelightlivingluxurymodernnobodyobjectpillowplaidroomsofaspacestudiostylestylishtabletrendzoning
Africa Images: the smart photo stock choice for your business
As a popular and trusted supplier of royalty-free stock photos covering a wide range of themes and topics, our collections are ideal for use in commercial and non-commercial projects. With a team of experts who not only update the galleries daily but also monitor the latest trends, you can have confidence that our high-resolution images are not only relevant but also of the best quality. We pay great attention to every detail — be it a chair, plate of food, or laptop, that is featured in our pictures. No matter the size or resolution you need, you will be able to choose the perfect picture that best suits your creative needs from our user-friendly website.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Business owners love our photo stock for the purchasing experience
We are a trusted supplier of stock images because we offer our users an efficient and enjoyable experience when using our platform. This, combined with payment protection and cost-effective pricing plans, means that you get a full suite of features and benefits that you likely won’t find with other providers. From browsing to selecting, purchasing, downloading, and using your new images, it only takes a matter of minutes from start to finish. Review our license comparison summary for what is allowed and included with each package so you know whether our Standard or Extended options are best for your creative requirements.