
Homemade protective face masks on grey stone table, flat lay. Space for text
Stock Photo ID: 550143
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Homemade protective face masks on grey stone table, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 20 Aug 2020
You may use our image “Homemade protective face masks on grey stone table, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
19airbackgroundbacteriabreathcarecleanclothcopycoronacoronaviruscottoncoviddifferentdiseasediyepidemicfabricfacefashionfilterflatflugreyhandmadehealthhomemadeinfectionlaymasksmedicalmouthnobodyobjectoutbreakpandemicpersonalpreventionprotectivequarantinesafetysewingsickspacestonesurgicaltabletexttopview
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
Develop a responsible stock photo strategy for your brand
Understanding stock photos and how to use them responsibly doesn’t need to be confusing. Stock images, such as those on our website, have already been taken, edited and are ready to use. We then make them available for licensing, meaning content creators and businesses pay a fee to get the right to use the image in your designs and creative projects legally. With royalty-free images, this gives you a wide range of usage rights over one stock image for a cost-effective price. For both commercial and non-commercial projects, consider us as your visual partner in responsibly bolstering your creative output and sales.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.