
Happy young man in Christmas sweater and funny glasses on light blue background
Stock Photo ID: 1492271
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Happy young man in Christmas sweater and funny glasses on light blue background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 1 Nov 2023
You may use our image “Happy young man in Christmas sweater and funny glasses on light blue background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultapparelbackgroundbluecasualcaucasianchristmasclothesclothingcolorcomfortdecemberdeerdesignfabricfashionfestivefunnygarmentglasseshappyholidayjumperknittedlightmalemanmerrynewornamentpartypatternpersonportraitredseasonalsmilingstylesweatertextiletraditionaluglywearwearingwinterwoolenxmasyearyoung
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Craft strong narratives with stock photos for visual storytelling
In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Discover a photo stock where creativity meets uniqueness
Keep your creative projects on top with our daily updated photos. Take advantage of a selection of out-of-the-ordinary pictures and illustrations only available on this site, while checking out a free image gallery that includes a broad range of categories over 130 pages, including sports, food, cosmetics, and much more. Read our informative blog posts that give helpful hints and tips on how to better use our stock images in your business activities and design work. These are just some of the additional features and benefits of our photo stock service that are popular with business owners, marketers, designers, teachers, and bloggers.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Do more with less, thanks to our cost-effective pricing options
With so much choice on offer online when it comes to stock images, finding a provider who not only has the best quality and most diverse range of pictures available but also makes the user experience simple yet effective from start to finish can be difficult. Not with our photo stock. Our Standard and Extended on-demand pricing packs give you options when it comes to the number of images per download, with cost savings available for the more you buy. The more photos you download, the more creative you can be in your projects. Take advantage of our platform today.