Happy young couple with cups in trailer. Camping vacation
Stock Photo ID: 587459
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Happy young couple with cups in trailer. Camping vacation”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.You may use our image “Happy young couple with cups in trailer. Camping vacation” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultadventurebackgroundcampcampercampingcaravancaucasiancomfortcouplecupsdrinkfamilyfemalehappyhealthyhobbyholidayhomeinsidekitchenleisurelifestyleloveluxurymalemanmotormotorhomepeopleportraitrelaxrelaxationrestruralrvseasonsmilingsummertableteapottourismtrailertraveltripvacationvanvehiclewomanyoung
Africa Images: your destination for creative visuals
Africa Images, owned by Africa Studio, is dedicated to offering the newest and widest range of high-quality stock pictures. With all types and subcategories of images, such as hygiene products and interiors, it is easy to find what you are looking for in our vast photo collections. Our “Featured collections” gallery is home to the latest trending and popular photos and is an excellent source of inspiration for your advertising and marketing campaigns. Content creators and business owners can not only boost their sales, but also increase their visibility in the market thanks to the bonus features and benefits on offer, including free images, previews, and unlimited downloads.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Help your brand standout with a wide range of image categories
Our expertly curated photo stock collections ensure you get a highly visual experience that speaks volumes about style and excellence. With categories dedicated to everyday scenes as well as more specialist subjects, we regularly update our collections, so they reflect the latest trends and popular materials, including stunning home decor, sleek salons, and spas, as well as appetizing scenes for fresh food and drinks. Think of a theme or have an image idea for your next project, and we will likely have it on our website. Simply browse our extensive collections for inspiration and that perfect picture before downloading and using your photos.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.