![Happy mother and daughter with flowers on white background. International Women's Day Photo of Happy mother and daughter with flowers on white background. International Women's Day](https://static.africaimages.com/photos/b/i/bivKTRScUPUYxT5R7ihPA5lCz/bivKTRScUPUYxT5R7ihPA5lCz_normal.jpg)
Happy mother and daughter with flowers on white background. International Women's Day
Stock Photo ID: 359282
Large 4896 × 4213 px, JPG 172.72 × 148.63 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Happy mother and daughter with flowers on white background. International Women's Day”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4896 × 4213 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 7 Feb 2019
You may use our image “Happy mother and daughter with flowers on white background. International Women's Day” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
8adultbackgroundbeautifulbirthdaybouquetcaucasiancelebrationchildcutedaughterdayeighteventfamilyfemalefestiveflowersgiftgirlgivinggreetinghappyholidayhuginternationalisolatedkidkisslifestylelittlelovemarchmaturemommothermotherhoodparentpeopleportraitpresentseasonsmilingspringsurprisetogethertulipwhitewomanwomen
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
The purchasing experience on our stock image platform is a standout
To keep customers happy in a competitive marketplace, we understand that their online experience must be seamless. This is why we have an intuitive website, designed and tailored to meet our users’ specific needs. From start to finish, the process of finding, purchasing, and downloading your chosen images is simple regardless of whether you’re coming to the site with an exact image in mind or with a creative idea to explore in more detail. Our handy license comparison summary will help you understand which type of on-demand pack you require (Standard or Extended) based on the image use and agreement terms.