![Happy mother and daughter with flowers on white background. International Women's Day Photo of Happy mother and daughter with flowers on white background. International Women's Day](https://static.africaimages.com/photos/u/x/uxx8T1Sd3x8fvz5aOucl04otn/uxx8T1Sd3x8fvz5aOucl04otn_normal.jpg)
Happy mother and daughter with flowers on white background. International Women's Day
Stock Photo ID: 358561
Large 5070 × 4326 px, JPG 178.86 × 152.61 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Happy mother and daughter with flowers on white background. International Women's Day”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5070 × 4326 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 7 Feb 2019
You may use our image “Happy mother and daughter with flowers on white background. International Women's Day” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
8adultbackgroundbeautifulbeautybirthdaybouquetcaucasiancelebrationchildcutedaughterdayeighteventfamilyfemalefestiveflowersgiftgirlgivinggreetinghappyholidayhuginternationalisolatedkidlifestylelittlelovemarchmaturemommothermotherhoodparentpeopleportraitpresentseasonsmilingspringsurprisetogethertulipwhitewomanwomen
Propel your brand's success with Africa Images’ royalty-free photos
At Africa Images — a part of Africa Studio, we offer compelling visual content that will raise your brand profile and enhance your creative projects. Before we upload an image to one of our vast collections, a team of professionals, including designers, models, photographers, and experienced retouchers, pay special attention to even the small details like the furniture, food, and technology captured in a picture. By so doing, we create quality materials that will help to uniquely exemplify your brand. Our wide range of stock photos and graphics are designed exclusively to help achieve your company objectives, so think of Africa Images for all your commercial design needs.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We offer flexible pricing plans to help you craft visual excellence
When it comes to finding not only the best quality but affordable images, we are the photo stock of choice. We offer cost-effective on-demand pricing plans that don't break the bank. Priced from only $5 per high-resolution image on our Standard license and a bulk saving when you purchase 10 images for $25, this will give you the opportunity to save in the long run and have more photos available when you need them for your upcoming campaigns. From browsing our collections for your desired pictures to purchasing and downloading them, we have made the process as smooth and as enjoyable as possible for the ultimate buyer experience.