![Happy man with milk mustache holding glass of tasty dairy drink on gray background Photo of Happy man with milk mustache holding glass of tasty dairy drink on gray background](https://static.africaimages.com/photos/j/4/j4mTVy5TdMwKZWEv2XPyrmUsS/j4mTVy5TdMwKZWEv2XPyrmUsS_normal.jpg)
Happy man with milk mustache holding glass of tasty dairy drink on gray background
Stock Photo ID: 1628399
Large 4480 × 6720 px, JPG 158.04 × 237.07 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Happy man with milk mustache holding glass of tasty dairy drink on gray background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4480 × 6720 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 19 Jan 2024
You may use our image “Happy man with milk mustache holding glass of tasty dairy drink on gray background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundbeveragebiobreakfastcalciumcaucasiancowcreamdairydeliciousdenimdessertdietdrinkfreshfreshnessglassgrayhappyhealthhealthyholdingingredientjacketlactoselifestyleliquidmalemanmilkmorningmustachenaturalnutritionorganicpasteurizedpersonportraitproductproteinrefreshmentsmilingstudiotastyverticalvitaminwhiteyoghurtyoung
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Discover how pictures can drive brand engagement and loyalty
When done professionally and with purpose, images can drive significant engagement and brand recognition for your business. The lasting presence of an image can enhance a piece of content’s reach while also keeping it alive in the reader’s mind. Investing in high-quality, royalty-free images could be different between potential customers choosing your brand over competitors. If you want your campaign or next piece of content to drive maximum impact and be faster and more effective, our photo stock will enable you to create impressive visual strategies. You can trust in our professional photography to enhance your advertisement campaigns or promotions.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.