Happy housewife with tomatoes and cucumbers on light blue background
Stock Photo ID: 1762281
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Happy housewife with tomatoes and cucumbers on light blue background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 16 Apr 2024
You may use our image “Happy housewife with tomatoes and cucumbers on light blue background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultageapronbackgroundbluecarecaucasianchefchorescookcookingcucumberscuisineculinarydinnerdomesticeatfemalefoodfreshhappyheadbandhobbyhomehousehouseholdhousekeephousekeeperhousekeepinghousewifehouseworkkitchenlifestylelightmaidmiddlepersonportraitproductsaladseniorsmilingtomatoesvegetablevitaminwoman
Africa Images: where quality and creativity come together in harmony
Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.
Craft strong narratives with stock photos for visual storytelling
In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Our photo stock service offers more than just great images
Enhance your photography endeavors by using a leading online picture stock. Enjoy an endless stream of the latest trending content and an assortment of unique pictures you will not find anywhere else. You can also take advantage of our complimentary gallery, containing over 100 pages of free visuals on everything from flowers to hygiene, cooking, and much more. Learn how to properly use your downloaded stock images thanks to our blog section, which gives helpful hints, tips, and inspiration for styling, advertising, and marketing your designs. As a result of offering our users these additional features and benefits, our services stand out, so you will, too.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.