Happy couple with drink on city waterfront
Stock Photo ID: 639408
Large 6280 × 4187 px, JPG 221.54 × 147.71 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Happy couple with drink on city waterfront”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6280 × 4187 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 19 Aug 2020
You may use our image “Happy couple with drink on city waterfront” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultaffectionbackgroundbeautifulboyfriendcarecasualcaucasiancitycoffeecopycouplecupdatedaydrinkfamilyfemalegirlfriendhappyhughusbandleisurelifestylelovelymalemannatureoutdoorspeopleportraitrelationshipriverromanticseasonsmilingspacespendingspringsummersunglassessunnytexttimetogetherwalkingwaterwaterfrontwifewoman
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Craft strong narratives with stock photos for visual storytelling
In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.