
Green hot chili peppers on white background
Stock Photo ID: 22144
Large 4958 × 3545 px, JPG 174.91 × 125.06 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Green hot chili peppers on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4958 × 3545 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 29 May 2020
You may use our image “Green hot chili peppers on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbrightburningcapsaicincayennechilechilichillicolorcookcookingcuisineculinarydeliciousdieteatflavorfoodfreshgastronomygourmetgreenhealthhealthyhotingredientisolatedkitchenmexicanmexiconaturalnutritionobjectorganicpaprikapepperpeppersplantrawreciperipespicespicytastyveganvegetablevegetarianwhitewhole
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Enhance your content campaigns with unique image categories
We have millions of photos that get updated regularly, so you can easily find the right photos that reflect your vision and perfectly illustrate your projects. You can browse, download, and purchase from the extensive collection of innovative, current, and trending stock images to stay one step ahead of the competition. From home interiors to spas and seasonal, no matter what business you work in, or your role, there’s plenty of choice and a variety of pictures available. For your convenience, all our stock photos are arranged by category, making it quicker to find exactly what you need for your initiatives.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.