
Glass of fresh milk isolated on white, top view
Stock Photo ID: 1402456
Large 3446 × 3219 px, JPG 121.57 × 113.56 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Glass of fresh milk isolated on white, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 3446 × 3219 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 3 Jun 2023
You may use our image “Glass of fresh milk isolated on white, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbeveragebreakfastcalciumcoldcoolcowcreamdairydietdietarydrinkdrinkingfoodfreefreshfreshnessfullglassgourmethealthyingredientisolatedlactoselifestyleliquidmilkmilkymorningnaturalnutrientnutritionobjectoneorganicpasteurizedproductproteinrawrefreshrefreshmentshakesoytastytopveganviewvitaminwhiteyogurt
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
Revitalize your visual content with the latest stock images
Your go-to online photo stock provides the perfect place for you to immerse yourself in creativity. Enjoy a constant flow of fresh content, including a collection of unique photos not available elsewhere. We also have a huge free image gallery covering an array of topics whereas our blog gives you invaluable ideas, tactics, and techniques on how to use stock imagery for business and creative growth. These additional benefits and features of our service make us a popular choice for content creators and business owners alike to upgrade both commercial and non-commercial projects. Reap the rewards of using our site today and enjoy amazing new content for your campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.