
Fresh ripe Chinese cabbages on white background
Stock Photo ID: 618657
Large 6720 × 3395 px, JPG 237.07 × 119.77 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Fresh ripe Chinese cabbages on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 3395 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 28 Aug 2020
You may use our image “Fresh ripe Chinese cabbages on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
agricultureantioxidantbackgroundcabbagecabbageschinesecookcuisineculinarydeliciousdieteatfiberfoodfoodstufffreshgastronomygourmetgreengroceryharvesthealthhealthyingredientisolatedjuicyleafmealnapanaturalnobodynutrientnutritionobjectorganicplantproductrawreciperipesaladsnacktastyveganvegetablevegetarianveggievitaminwhitewhole
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Boost your brand profile with our versatile image categories
Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a pleasant shopping experience on our easy-to-use site
Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.