Fresh ripe acai berries as background, closeup
Stock Photo ID: 549028
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Fresh ripe acai berries as background, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 22 Jun 2020
You may use our image “Fresh ripe acai berries as background, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
acaiagricultureantioxidantassaibackdropbackgroundberriesbraziliancloseupcookcropdeliciouseatenergyexoticfoodfreshfruitharvesthealthyingredientjuicymanynaturalnobodynutrientobjectorganicpalmpurplerawreciperipeseasonsnacksupersuperfoodsuperfruitsweettastytoptropicalveganvegetarianviewvitalityvitaminswallpaperwholesome
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Unravel the importance of ethical licensing with stock photography
When using stock images, you can have professional designs for your website, ads, brochures, and signs without breaking the bank or taking any legal risks. By downloading royalty-free pictures directly from our website, content creators can use them in all the ways accepted by our license agreements, including commercial use such as in marketing materials and more, legally. Whether you are looking for Standard or Extended license stock photography for your blog posts, billboards, social media pages, banners, promotional materials, or some other creative idea, you will find inspiring and engaging high-res images of all kinds at our photo stock.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Popular stock photos to help your business stand out from the crowd
Our photo stock is a highly respected and favored platform for sourcing high-quality visuals. With daily content updates, our users can stay one step ahead of the competition. Looking for unique images? A number of the pictures we have on our site are exclusive to this platform. In addition to this, we provide a free gallery with more than 100 pages of pictures which can be filtered according to what you are searching for. Visit our blog for practical advice on how to use stock photos in commercial and creative projects. Africa Images is where designers, bloggers, and marketers come to make an impact with our distinctive and inspiring photos.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Make your budget stretch further with our affordable pricing
We all want to make our money go that little bit further, which is why our photo stock provides not only high-quality visuals but also different payment plans that provide bulk savings the more you download. For our Standard on-demand pack, you can get 10 high-resolution images for as little as $25 — a mere $2.50 per image. Needing to do more with your pictures? The Extended option license allows for unlimited printed reproductions as well as outdoor advertising. Unlike the Standard plan, you can also use your downloads on products for sale or distribution, digital templates for sale or distribution, and designs for a business or commercial space.