![Fresh raw broccolini isolated on white. Healthy food Photo of Fresh raw broccolini isolated on white. Healthy food](https://static.africaimages.com/photos/n/W/nWpeS7i4cntOvw6RMlc5ZbzMR/nWpeS7i4cntOvw6RMlc5ZbzMR_normal.jpg)
Fresh raw broccolini isolated on white. Healthy food
Stock Photo ID: 1354860
Large 5283 × 3717 px, JPG 186.37 × 131.13 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Fresh raw broccolini isolated on white. Healthy food”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5283 × 3717 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Apr 2023
You may use our image “Fresh raw broccolini isolated on white. Healthy food” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
agriculturebackgroundbranchbrightbroccolibroccolinibundlecabbagecolorcookcookingcuisineculinarydeliciousdietdietingeatfoodfreshfreshnessgastronomygourmetgreengreenshealthhealthyingredientisolatednaturalnutrientnutrientsnutritionobjectorganicproductrawripesaladsnackstemtastytiedveganvegetablevegetarianveggievitaminwhite
Tell a visual story with Africa Images’ high-resolution photo stock
With high-quality stock photos that are updated daily, Africa Images will create a unique market presence for your brand. Our team knows the importance of having a professional business profile to enhance your reputation, and our royalty-free images will help you stand out from the competition. You can easily find animal, insurance, medical, or even finance photos, among others, on our website, which we have designed to be as user-friendly as possible. The dedicated team at Africa Images constantly monitors and tracks emerging trends and popular themes to guarantee that you will always be that one step ahead.
We are your go-to destination for ethical stock photography
We believe that stock images should be used with an awareness of copyright and ethics. That’s why all the pictures on our website are copyrighted, which means someone owns them. Content creators can buy a license to avoid any possible legal issues with the stock images they download. Meaning protection for you, as well as the image owner. We offer two types of licenses, a Standard and an Extended license, with each type clearly determining how the downloaded material can be used. Have peace of mind when exploring our visuals that our licensing ensures integrity with every single captivating photo.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
Experience the latest free photos and added-value extras
Our modern online photo stock will impress you and your audience. Indulge in a daily update of the latest visual content and find an assortment of images that can only be found on our platform. Our complimentary gallery is home to over 100 pages of free pictures, across a wide range of themes, including happy families, packaging, and medical instruments, to name just a few. Read our blog posts for valuable advice and tips on how adding our stock photos to your work can boost the recall and interaction. These added value extras to our service are invaluable for marketers, designers, teachers, and anyone looking to enhance their projects.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.