
Fresh raw broccolini isolated on white. Healthy food
Stock Photo ID: 1353553
Large 4871 × 4480 px, JPG 171.84 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Fresh raw broccolini isolated on white. Healthy food”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4871 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Apr 2023
You may use our image “Fresh raw broccolini isolated on white. Healthy food” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
agriculturebackgroundbranchbrightbroccolibroccolinicabbagecolorcookcookingcuisineculinarydeliciousdietdietingeatfoodfreshfreshnessgastronomygourmetgreengreenshealthhealthyingredientisolatednaturalnutrientnutrientsnutritionobjectorganicproductrawripesaladsnackstemtastyveganvegetablevegetarianveggievitaminwhite
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.