Foreign languages teacher near whiteboard with different flags in modern classroom
Stock Photo ID: 939487
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Foreign languages teacher near whiteboard with different flags in modern classroom”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 15 Jun 2022
You may use our image “Foreign languages teacher near whiteboard with different flags in modern classroom” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultamericanbackgroundcaucasianclassclassesclassroomcollegeconnectedcoursesdifferenteducationeveningfemaleflagsforeignfrenchgermanglasseshappyindividualinternetitalianjobknowledgelanguageslearninglecturerlessonmentormodernoccupationonlinepersonschoolscienceskillsmilestudentstudystudyingteacherteachingtrainingtutoruniversitywhiteboardwomanyoung
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Safeguard your business with our royalty-free licensed visuals
As a reputed supplier of high-quality stock photography, business owners have peace of mind when it comes to sourcing and downloading licensed visuals from our site. Regardless of what you need photo content for, there are unlimited options for the pictures you get. As well as being high-resolution and versatile for promotional activities such as marketing, advertising, social media, and web design, our pictures promote responsible image use and will leave a lasting impact not only on your audience but also in licensing on the digital and traditional landscape. Discover today how your image choices will leave a positive legacy.
Immerse in a visual wonderland with exceptional photo collections
Go on an epic visual journey with our expansive stock photo categories that go from routine life moments to unexpected encounters and events. Discover hot topics around home interiors, holidays, happy families, and the freshest foods including healthy vegetables, as just a few examples. We take great care in curating our collections, selecting only superior quality and eye-catching images to feature on our site. Our goal is to provide you with the ultimate resource and inspiration for your projects. We ensure our collections are regularly updated so that your projects are current, and your business and creative endeavors outshine the competition.
Discover a photo stock where creativity meets uniqueness
Keep your creative projects on top with our daily updated photos. Take advantage of a selection of out-of-the-ordinary pictures and illustrations only available on this site, while checking out a free image gallery that includes a broad range of categories over 130 pages, including sports, food, cosmetics, and much more. Read our informative blog posts that give helpful hints and tips on how to better use our stock images in your business activities and design work. These are just some of the additional features and benefits of our photo stock service that are popular with business owners, marketers, designers, teachers, and bloggers.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.