Food blogger taking photo of her lunch at wooden table indoors, closeup
Stock Photo ID: 128933
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Food blogger taking photo of her lunch at wooden table indoors, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 11 Nov 2019
You may use our image “Food blogger taking photo of her lunch at wooden table indoors, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundblogbloggerbreadbusinesscloseupcomputercookingculinarydevicedigitaldinnerdrinkeateggfemalefoodgirlglasshandsindoorsinternetjuicelaptoplifestylelunchmodernnotebookonlinepersonphonephotopoachedsaladsavvyscreensitesmartphonestylishtabletakingtechtechnologytrendytutorialwomanwoodenworkyoung
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
We are your go-to destination for ethical stock photography
We believe that stock images should be used with an awareness of copyright and ethics. That’s why all the pictures on our website are copyrighted, which means someone owns them. Content creators can buy a license to avoid any possible legal issues with the stock images they download. Meaning protection for you, as well as the image owner. We offer two types of licenses, a Standard and an Extended license, with each type clearly determining how the downloaded material can be used. Have peace of mind when exploring our visuals that our licensing ensures integrity with every single captivating photo.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From payment to download, experience a seamless online journey
As a leading online supplier of stock images, users can experience great customer satisfaction from start to finish when it comes to downloading their chosen pictures. The process of finding exactly what you are looking for and comparing the different license plans available results in an enhanced purchase interaction. You can choose from a Standard or Extended on-demand pack depending on how you plan to use your new downloads. Both options also provide savings when purchasing in bulk. So not only is this more cost-effective but it means you can bank these additional photos for future use in your work initiatives.