Flat lay composition with jar of chocolate curls on wooden background. Space for text
Stock Photo ID: 327134
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Flat lay composition with jar of chocolate curls on wooden background. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 15 Nov 2018
You may use our image “Flat lay composition with jar of chocolate curls on wooden background. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
antioxidantbackgroundbrowncacaocaloriecaloriescandychocolatecocoacoiledcompositionconfectionconfectionerycopycurlcurlsdarkdecorationdeliciousdesserteatelementflakeflatflavorfoodgourmetgratedhealthyingredientjarlaynaturalnutrientnutritionobjectorganicpieceproductrollshavingssmallspacespiralsweettastytexttopviewwooden
Africa Images: where quality and creativity come together in harmony
Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.