
Firefighter in uniform on fire truck outdoors, back view
Stock Photo ID: 1825714
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Firefighter in uniform on fire truck outdoors, back view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 29 Apr 2024
You may use our image “Firefighter in uniform on fire truck outdoors, back view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
911accidentactionadultageangleautoautomobilebackbackgroundbluebravecardangerdangerousdepartmentemergencyfighterfirefirefighterfirefightingfiremanflamehelmethelpherolowmalemanmiddleorangeoutdoorspersonprofessionalprotectionprotectiverescuerisksafesafetysaveserviceskyspacetransporttransportationtruckuniformviewwork
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Develop a responsible stock photo strategy for your brand
Understanding stock photos and how to use them responsibly doesn’t need to be confusing. Stock images, such as those on our website, have already been taken, edited and are ready to use. We then make them available for licensing, meaning content creators and businesses pay a fee to get the right to use the image in your designs and creative projects legally. With royalty-free images, this gives you a wide range of usage rights over one stock image for a cost-effective price. For both commercial and non-commercial projects, consider us as your visual partner in responsibly bolstering your creative output and sales.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Our photo stock service offers more than just great images
Enhance your photography endeavors by using a leading online picture stock. Enjoy an endless stream of the latest trending content and an assortment of unique pictures you will not find anywhere else. You can also take advantage of our complimentary gallery, containing over 100 pages of free visuals on everything from flowers to hygiene, cooking, and much more. Learn how to properly use your downloaded stock images thanks to our blog section, which gives helpful hints, tips, and inspiration for styling, advertising, and marketing your designs. As a result of offering our users these additional features and benefits, our services stand out, so you will, too.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.