
Fertility doctor demonstrating model of female reproductive system to couple in clinic. Patient consultation
Stock Photo ID: 1280258
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Fertility doctor demonstrating model of female reproductive system to couple in clinic. Patient consultation”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 23 Feb 2023
You may use our image “Fertility doctor demonstrating model of female reproductive system to couple in clinic. Patient consultation” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultappointmentbackgroundcarecaucasiancheckupclinicclipboardconsultationcoupledemonstratingdiagnosticdoctorexamexaminationfemalefertilityhappyhavinghealthhospitalindoorsinfertilityivfmalemanmedicmedicalmedicinemodelpatientpeoplepregnancyprofessionalreproductivereproductologistserviceshowingsmilesmilingspecialiststethoscopesystemtabletesttreatmentvisitwomenyoung
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Shape your brand narratives with high-resolution stock photos
In a well-planned marketing campaign, imagery can play a crucial role in telling your brand’s story. It provides those all-important visual clues to both existing and new customers, which will help them align with your business and understand how it could fit into their lives. With the potential to evoke specific emotions, stock images can be a powerful way to build strong customer relationships and convey your brand’s story. The variety and quality of photos available at Africa Images will help to get your point across quickly while saving time and money, helping to increase conversions and provide a richer customer experience.
Transform your projects with creative imagery collections
Enhance your creative work with a huge collection of stock images that more than stand out from the crowd. There are a number of thematic categories, depending on whether you are looking for ordinary, everyday lifestyle pictures or something a little more different and unique. Regularly updated to stay current and relevant, our engaging image collections showcase modern and trending photos, including interior designs, happy families, holidays, fresh foods, and more; only the best visuals are selected and made available on the platform. With this high-quality photo stock, every picture can transform uninspiring and plain creatives to compelling visual stories.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.