Energy drinks in colorful cans on yellow background
Stock Photo ID: 1660615
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Energy drinks in colorful cans on yellow background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 8 Feb 2024
You may use our image “Energy drinks in colorful cans on yellow background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
activeactivityaddictionalcoholaluminumbackgroundbeverageblackblankcaffeinecancanscarbonatedcolorfulcontainercopydesigndifferentdrinkdrinkseffectemptyenergyfizzyfreshfunctionalhealthlifestyleliquidmetalmetallicmockupnutritionobjectpackagepackagingpartyproductredrefreshmentspacesteelstimulantstrengthsugartabtaurinetexttinyellow
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Download inspiring visuals from our extensive image collections
Explore the creativity behind the selection process for our diverse stock photo categories. From the everyday existence images through to one-off events and celebrations, you will also find popular and trending themed collections including aspirational interior design, soothing spas, wanderlust holidays and travel, healthy fresh foods, and so much more. These varied categories are regularly reviewed and updated by our team, ensuring they are current, inspiring and keep your brand efforts fresh and effective. Every single picture is a carefully crafted and styled work of art, expertly selected for your satisfaction above and beyond the expectation of a photo stock.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.