Energy drink in blue can on black wooden table
Stock Photo ID: 1664690
Large 4867 × 3273 px, JPG 41.21 × 27.71 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Energy drink in blue can on black wooden table”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4867 × 3273 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 8 Feb 2024
You may use our image “Energy drink in blue can on black wooden table” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
activeactivityaddictionalcoholaluminumbackgroundbeverageblackblankbluecaffeinecancarbonatedcontainercopydesigndrinkeffectemptyenergyfizzyfreshfreshnessfunctionalhealthlifestyleliquidmetalmetallicmockupnutritionobjectonepackagepackagingpartyproductrefreshmentsinglespacesteelstimulantstrengthsugartabtabletaurinetexttinwooden
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Help your brand standout with a wide range of image categories
Our expertly curated photo stock collections ensure you get a highly visual experience that speaks volumes about style and excellence. With categories dedicated to everyday scenes as well as more specialist subjects, we regularly update our collections, so they reflect the latest trends and popular materials, including stunning home decor, sleek salons, and spas, as well as appetizing scenes for fresh food and drinks. Think of a theme or have an image idea for your next project, and we will likely have it on our website. Simply browse our extensive collections for inspiration and that perfect picture before downloading and using your photos.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.