Image of Email. Light blue button with illustration of envelope on computer keyboard, view through magnifying glass, closeup
Release info: property release for this stock photo is signed with Africa Studio.

Email. Light blue button with illustration of envelope on computer keyboard, view through magnifying glass, closeup

Stock Photo ID: 1788252
Large 6604 × 4403 px, JPG 232.97 × 155.33 cm
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Email. Light blue button with illustration of envelope on computer keyboard, view through magnifying glass, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6604 × 4403 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 1 May 2024
You may use our image “Email. Light blue button with illustration of envelope on computer keyboard, view through magnifying glass, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.

Find stock photos using keywords

addressbackgroundbluebusinessbuttonchatcloseupcommunicationcomputerconnectioncontactcorrespondencedatadesigndigitale-mailelectronicemailenvelopeglassillustrationinformationinternetkeykeyboardkeypadletterlightmagnifyingmailmailboxmarketingmediamessagemodernnetworknewsletterobjectofficeonlinepostreceivesendsignsocialsymboltechnologyviewwebwork

Similar stock images

Image of Email. Light blue button with illustration of envelope on computer keyboard, closeup
Email. Light blue button with illustration of envelope on computer keyboard, closeup
Image of Email. Red button with illustration of envelope on computer keyboard, view through magnifying glass, closeup
Email. Red button with illustration of envelope on computer keyboard, view through magnifying glass, closeup
Image of Light blue button with word Email and illustration of envelope on computer keyboard, closeup
Light blue button with word Email and illustration of envelope on computer keyboard, closeup
Image of Red button with word Email and illustration of envelope on keyboard, top view
Red button with word Email and illustration of envelope on keyboard, top view
Image of Light blue button with word Email and illustration of envelope on keyboard, top view
Light blue button with word Email and illustration of envelope on keyboard, top view
Image of Email. Light blue button with illustration of envelope on computer keyboard, closeup
Email. Light blue button with illustration of envelope on computer keyboard, closeup
Image of Red button with word Email and illustration of envelope on laptop keyboard, top view
Red button with word Email and illustration of envelope on laptop keyboard, top view
Image of Red button with word Email and illustration of envelope on laptop keyboard, closeup
Red button with word Email and illustration of envelope on laptop keyboard, closeup
Image of Email. Light blue button with illustration of envelope on computer keyboard, view through magnifying glass, closeup
Email. Light blue button with illustration of envelope on computer keyboard, view through magnifying glass, closeup
See All

Africa Images’ photo stock is the key to your visual success

The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.

High-quality stock photos can be transformative across industries

High-quality stock photos can play a significant role in meeting visual demands in various industries, from advertising and web design to journalism and marketing. They have the power to capture the essence of a brand and effectively convey messages, and evoke emotions. Our royalty-free images enable content creators and business owners alike to discover high-resolution pictures and illustrations that perfectly align with their project’s needs. Not only will you be able to find cost-effective and unique pictures that fit your creative vision, but ones that also adhere to the licensing and usage rights associated with the image.

Boost your brand profile with our versatile image categories

Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.

Get trending photos, free pictures, blog content, and more with us

Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.

Reliability is a guarantee that goes beyond pixels, and each click

Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.

Make your budget stretch further with our affordable pricing

We all want to make our money go that little bit further, which is why our photo stock provides not only high-quality visuals but also different payment plans that provide bulk savings the more you download. For our Standard on-demand pack, you can get 10 high-resolution images for as little as $25 — a mere $2.50 per image. Needing to do more with your pictures? The Extended option license allows for unlimited printed reproductions as well as outdoor advertising. Unlike the Standard plan, you can also use your downloads on products for sale or distribution, digital templates for sale or distribution, and designs for a business or commercial space.