Doctor giving water to senior man with protective mask at nursing home
Stock Photo ID: 741926
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Doctor giving water to senior man with protective mask at nursing home”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 4 Jun 2021
You may use our image “Doctor giving water to senior man with protective mask at nursing home” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultassistanceassistantbackgroundbedcarecaregivercaucasiancentercomplexcoronaviruscovid19doctordrinkfemalegeriatricgivingglasshappyhealthhelphomehouseindoorsinfectionlifestylemalemanmaskmaturemedicalmedicinenursenursingoldpatientpensionpensionerpeopleportraitprotectiveretirementroomseniorsittingsupportwardwaterwindowwoman
Propel your brand's success with Africa Images’ royalty-free photos
At Africa Images — a part of Africa Studio, we offer compelling visual content that will raise your brand profile and enhance your creative projects. Before we upload an image to one of our vast collections, a team of professionals, including designers, models, photographers, and experienced retouchers, pay special attention to even the small details like the furniture, food, and technology captured in a picture. By so doing, we create quality materials that will help to uniquely exemplify your brand. Our wide range of stock photos and graphics are designed exclusively to help achieve your company objectives, so think of Africa Images for all your commercial design needs.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Enhance your content campaigns with unique image categories
We have millions of photos that get updated regularly, so you can easily find the right photos that reflect your vision and perfectly illustrate your projects. You can browse, download, and purchase from the extensive collection of innovative, current, and trending stock images to stay one step ahead of the competition. From home interiors to spas and seasonal, no matter what business you work in, or your role, there’s plenty of choice and a variety of pictures available. For your convenience, all our stock photos are arranged by category, making it quicker to find exactly what you need for your initiatives.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get quality stock images for less with our on-demand pricing plans
Great stock images can be expensive, which is why we offer our customers two different license options that cater to their budget and image requirements. Depending on how you intend to use your new pictures, you can opt for a Standard or Extended pack — both of which come with bulk savings. The Extended option is ideal if you need unlimited downloads for printed reproductions or outdoor advertising and allows you to use the photos for products on sale or distribution, digital templates for sale or distribution, and for business and commercial space designs. Our handy license comparison chart will make it easier to find your ideal pricing plan.