Discount, offer, sale. Man showing mobile phone with percent sign on screen, grey background
Stock Photo ID: 1445434
Large 7000 × 4667 px, JPG 246.94 × 164.64 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Discount, offer, sale. Man showing mobile phone with percent sign on screen, grey background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 7000 × 4667 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 26 Oct 2023
You may use our image “Discount, offer, sale. Man showing mobile phone with percent sign on screen, grey background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultadvertisingbackgroundbusinessbuycaucasiancommercecommercialconsumerismcustomerdevicedigitaldiscountdisplayeconomyeventfinancialgadgetgreyhappyholdinghotillustrationinternetmalemanmarketingmobileofferonlinepercentpercentagepersonphonepricepromopromotionratesalescreenserviceshoppingshowingsignsmartphonesmilingspecialstoretechnology
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Enhance your content campaigns with unique image categories
We have millions of photos that get updated regularly, so you can easily find the right photos that reflect your vision and perfectly illustrate your projects. You can browse, download, and purchase from the extensive collection of innovative, current, and trending stock images to stay one step ahead of the competition. From home interiors to spas and seasonal, no matter what business you work in, or your role, there’s plenty of choice and a variety of pictures available. For your convenience, all our stock photos are arranged by category, making it quicker to find exactly what you need for your initiatives.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.