Different types of delicious nut butters and ingredients on white background, top view
Stock Photo ID: 874448
Large 6637 × 4281 px, JPG 234.14 × 151.02 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Different types of delicious nut butters and ingredients on white background, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6637 × 4281 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 18 Nov 2021
You may use our image “Different types of delicious nut butters and ingredients on white background, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
allergyalmondbackgroundbreakfastbutterscopycreamdeliciousdessertdietdifferenteatfatflatfoodfreshgourmethazelnuthealthyhomemadeingredientsisolatedlayleavesnaturalnobodynutnutritionobjectorganicpeanutpistachioproteinrawsmoothsnackspacespreadsweettastytexttoptypesvarietyveganvegetarianviewvitaminwalnutwhite
Discover the latest and best-trending stock photos at Africa Images
Africa Studio — your home of exceptional pictures — brings you Africa Images, a handpicked selection of high-resolution stock photos compiled by our top photographers and creators. We offer a range of different sizes and resolutions so that you can find the perfect image for your projects. Our dedicated team constantly tracks recent trends and popular materials and updates our photo collections daily with the latest images. Our visuals will make your creative ideas come to life and help you have an unforgettable and engaging marketing campaign. Use our royalty-free images to increase your brand’s visibility and raise product demand.
We are your go-to destination for ethical stock photography
We believe that stock images should be used with an awareness of copyright and ethics. That’s why all the pictures on our website are copyrighted, which means someone owns them. Content creators can buy a license to avoid any possible legal issues with the stock images they download. Meaning protection for you, as well as the image owner. We offer two types of licenses, a Standard and an Extended license, with each type clearly determining how the downloaded material can be used. Have peace of mind when exploring our visuals that our licensing ensures integrity with every single captivating photo.
Create magic with our expansive stock photography collections
Our varied range of image categories — from everyday scenes to highly specialized subjects — will keep you up to date with the latest visual and popular trends. With millions of images available on the platform, we are dedicated to offering the best possible royalty-free photos that meet the highest standards. In our regularly updated collections, you will see nothing but exceptional, beautiful pictures. Examine new trends in home interiors, salons, spas, businesses, and drinks, whose every category highlights the evolving landscape of visual storytelling. From A to Z, you will easily find the right images that reflect your brand vision and enhance your projects.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.