
Different towels and fresh vegetables on marble table
Stock Photo ID: 453410
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Different towels and fresh vegetables on marble table”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 17 Jun 2019
You may use our image “Different towels and fresh vegetables on marble table” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundboardcheckeredcleancleanlinesscleanseclothcolorconceptcookingcopycottondifferentdisposabledomesticdryfabricfoodfreshginghamhomehousehouseholdhousekeepinghouseworkhygienekitchenkitchenwareknifelinenmarblematerialnapkinobjectpaperpatternpicnicplateragredrollsofttabletextiletexturetoweltowelsvegetableswhitewipe
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Stock photographs can create a visual impact across industries
The correct use of visuals in business matters when it comes to the online environment. Amidst the constant information overloading and dwindling attention spans, businesses need to create unique ways through which they can catch and keep capturing the audience’s attention. We are proud to provide high-quality stock images, which include a variety of topics, themes, styles, and moods that help set the tone and build a connection between you and your audience. Irrespective of what industry you belong to, whether it is financial services, the cosmetics industry, or environmental studies, the ideal stock image can play a huge role in the interest and consideration of prospect customers.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get quality stock images for less with our on-demand pricing plans
Great stock images can be expensive, which is why we offer our customers two different license options that cater to their budget and image requirements. Depending on how you intend to use your new pictures, you can opt for a Standard or Extended pack — both of which come with bulk savings. The Extended option is ideal if you need unlimited downloads for printed reproductions or outdoor advertising and allows you to use the photos for products on sale or distribution, digital templates for sale or distribution, and for business and commercial space designs. Our handy license comparison chart will make it easier to find your ideal pricing plan.