Different tasty wines in glasses against blurred background
Stock Photo ID: 1722403
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Different tasty wines in glasses against blurred background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 8 Feb 2024
You may use our image “Different tasty wines in glasses against blurred background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
alcoholalcoholicbackgroundbarbeverageblurredboozecelebratechardonnaycollectiondegustationdeliciousdifferentdrinkeventexpensivefestiveflavourglassesgourmetgrapegroupliquidluxurymanynobodyobjectpartyqualityrestaurantsauvignontastetastingtastytraditionalvariousvinevineyardwhitewinewinemakingwinerywines
Propel your brand's success with Africa Images’ royalty-free photos
At Africa Images — a part of Africa Studio, we offer compelling visual content that will raise your brand profile and enhance your creative projects. Before we upload an image to one of our vast collections, a team of professionals, including designers, models, photographers, and experienced retouchers, pay special attention to even the small details like the furniture, food, and technology captured in a picture. By so doing, we create quality materials that will help to uniquely exemplify your brand. Our wide range of stock photos and graphics are designed exclusively to help achieve your company objectives, so think of Africa Images for all your commercial design needs.
Let your content showcase the emotive power of stock images
Content building is one of the most important aspects of today’s marketing and communication in an almost exclusively digital world. Regardless of the type of content, whether it is social media posts, blog posts, website content or even presentations, the visual impact of these materials is crucial to gain the audience’s attention. With time, stock photos have increased in popularity, becoming an effective way of improving the quality and power of content, as well as being educational, engaging, and entertaining. We have images to suit the visual style of your brand, helping to create the desired emotions and response from your target audience.
Transform your projects with creative imagery collections
Enhance your creative work with a huge collection of stock images that more than stand out from the crowd. There are a number of thematic categories, depending on whether you are looking for ordinary, everyday lifestyle pictures or something a little more different and unique. Regularly updated to stay current and relevant, our engaging image collections showcase modern and trending photos, including interior designs, happy families, holidays, fresh foods, and more; only the best visuals are selected and made available on the platform. With this high-quality photo stock, every picture can transform uninspiring and plain creatives to compelling visual stories.
Discover a photo stock where creativity meets uniqueness
Keep your creative projects on top with our daily updated photos. Take advantage of a selection of out-of-the-ordinary pictures and illustrations only available on this site, while checking out a free image gallery that includes a broad range of categories over 130 pages, including sports, food, cosmetics, and much more. Read our informative blog posts that give helpful hints and tips on how to better use our stock images in your business activities and design work. These are just some of the additional features and benefits of our photo stock service that are popular with business owners, marketers, designers, teachers, and bloggers.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
The purchasing experience on our stock image platform is a standout
To keep customers happy in a competitive marketplace, we understand that their online experience must be seamless. This is why we have an intuitive website, designed and tailored to meet our users’ specific needs. From start to finish, the process of finding, purchasing, and downloading your chosen images is simple regardless of whether you’re coming to the site with an exact image in mind or with a creative idea to explore in more detail. Our handy license comparison summary will help you understand which type of on-demand pack you require (Standard or Extended) based on the image use and agreement terms.