Different grains and cereals as background, top view
Stock Photo ID: 101737
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Different grains and cereals as background, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 4 Dec 2019
You may use our image “Different grains and cereals as background, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
agriculturalassortmentbackdropbackgroundbeanbrightbuckwheatcerealscolorfulcookculinarydeliciousdifferenteatfiberflakesfoodgastronomygourmetgrainsgroatshealthyingredientmanymilletmungnaturaloatobjectorganicpatternporridgepulsesredseedsquaretastytoptypesuncookedvarietyveganvegetarianviewwallpaperwhole
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.