
Different fresh citrus fruits and leaves in wicker basket on wooden table, above view
Stock Photo ID: 1631015
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Different fresh citrus fruits and leaves in wicker basket on wooden table, above view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 30 Jan 2024
You may use our image “Different fresh citrus fruits and leaves in wicker basket on wooden table, above view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
assortmentbackgroundbasketcitruscloseupcollectioncolorcolorfulcutdietdifferentexoticfoodfreshfruitsgrapefruitgreengroupharvesthealthhealthyingredientjuicyleaveslemonlimemanymixnaturalobjectorangeorganicpiecerefreshmentriperusticslicesoursummersweettabletastytropicalvegetarianviewvitaminwickerwoodenyellow
Tell a visual story with Africa Images’ high-resolution photo stock
With high-quality stock photos that are updated daily, Africa Images will create a unique market presence for your brand. Our team knows the importance of having a professional business profile to enhance your reputation, and our royalty-free images will help you stand out from the competition. You can easily find animal, insurance, medical, or even finance photos, among others, on our website, which we have designed to be as user-friendly as possible. The dedicated team at Africa Images constantly monitors and tracks emerging trends and popular themes to guarantee that you will always be that one step ahead.
Stock photographs can create a visual impact across industries
The correct use of visuals in business matters when it comes to the online environment. Amidst the constant information overloading and dwindling attention spans, businesses need to create unique ways through which they can catch and keep capturing the audience’s attention. We are proud to provide high-quality stock images, which include a variety of topics, themes, styles, and moods that help set the tone and build a connection between you and your audience. Irrespective of what industry you belong to, whether it is financial services, the cosmetics industry, or environmental studies, the ideal stock image can play a huge role in the interest and consideration of prospect customers.
Enhance your content campaigns with unique image categories
We have millions of photos that get updated regularly, so you can easily find the right photos that reflect your vision and perfectly illustrate your projects. You can browse, download, and purchase from the extensive collection of innovative, current, and trending stock images to stay one step ahead of the competition. From home interiors to spas and seasonal, no matter what business you work in, or your role, there’s plenty of choice and a variety of pictures available. For your convenience, all our stock photos are arranged by category, making it quicker to find exactly what you need for your initiatives.
Get trending photos, free pictures, blog content, and more with us
Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We offer flexible pricing plans to help you craft visual excellence
When it comes to finding not only the best quality but affordable images, we are the photo stock of choice. We offer cost-effective on-demand pricing plans that don't break the bank. Priced from only $5 per high-resolution image on our Standard license and a bulk saving when you purchase 10 images for $25, this will give you the opportunity to save in the long run and have more photos available when you need them for your upcoming campaigns. From browsing our collections for your desired pictures to purchasing and downloading them, we have made the process as smooth and as enjoyable as possible for the ultimate buyer experience.