![Delicious persimmon jam in glass jar and fresh fruits on white wooden table, closeup Photo of Delicious persimmon jam in glass jar and fresh fruits on white wooden table, closeup](https://static.africaimages.com/photos/T/F/TFhBSftq7WA0WJUajvQT37TNg/TFhBSftq7WA0WJUajvQT37TNg_normal.jpg)
Delicious persimmon jam in glass jar and fresh fruits on white wooden table, closeup
Stock Photo ID: 1583161
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Delicious persimmon jam in glass jar and fresh fruits on white wooden table, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 10 Jan 2024
You may use our image “Delicious persimmon jam in glass jar and fresh fruits on white wooden table, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbasketcloseupcolorconfitureconservecookculinarydeliciousdessertdieteateatingflavorfoodfreshfruitfruitsgastronomyglassgourmethealthyhomemadeingredientjamjarjellykitchenmarmaladenaturalnutrientnutritionobjectorangeorganicpersimmonpreserverecipeseasonalsugarsweettabletastyveganvegetarianvitaminwhitewickerwoodenyummy
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Discover diverse image categories for every creative need
We have developed an impressive collection of stock photo categories that cover aspects of people’s everyday lives up to niche ideas and events to help you keep track of visual trends. By providing exceptional curated images that inspire and spark a positive response from your audience, we reflect the quality standard we observe. Our user-friendly filters and keyword functions can be used on our search page to further refine your results. Discover different aspects of popular home interiors, salons, birthday celebrations, drinks, and other themes that reflect the changes in modern visuals. Make use of these vast photo collections to upgrade your projects and add a touch of style to your brand story in the form of imagery.
Our photo stock service offers more than just great images
Enhance your photography endeavors by using a leading online picture stock. Enjoy an endless stream of the latest trending content and an assortment of unique pictures you will not find anywhere else. You can also take advantage of our complimentary gallery, containing over 100 pages of free visuals on everything from flowers to hygiene, cooking, and much more. Learn how to properly use your downloaded stock images thanks to our blog section, which gives helpful hints, tips, and inspiration for styling, advertising, and marketing your designs. As a result of offering our users these additional features and benefits, our services stand out, so you will, too.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.