Delicious heart shaped cookies on white background, top view. Valentine's Day
Stock Photo ID: 654460
Large 5430 × 4054 px, JPG 191.56 × 143.02 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Delicious heart shaped cookies on white background, top view. Valentine's Day”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5430 × 4054 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 20 Jan 2021
You may use our image “Delicious heart shaped cookies on white background, top view. Valentine's Day” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbakingbeautifulbiscuitcakeconfectionerycookiecookiesdaydecorateddecorationdeliciousdessertdifferentdoteatfebruaryfestivefoodgiftgingerbreadhandmadehappyhearthomemadeicingisolatedlovemanyminenutritionobjectpastryplatepolkapresentredromanceromanticshapeshapedsnacksweettastytoptreatvalentineviewwhiteyummy
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
Encounter a world of special imagery with our popular photo stock
Your visuals will always be cutting-edge with our fast-moving online photo stock. Relish fresh and original content accompanied by a free image gallery with over 100 pages covering different themes and topics, including sports, cosmetics, food, fashion, and much more. Take a read of our inspiring blog posts, where we offer handy hints and tips that can be used in business and creative campaigns to boost the power of stock images. So, if you are looking for high-quality images to enhance either your commercial or non-commercial projects, along with added benefits and service features, you have come to the right place.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Make your budget stretch further with our affordable pricing
We all want to make our money go that little bit further, which is why our photo stock provides not only high-quality visuals but also different payment plans that provide bulk savings the more you download. For our Standard on-demand pack, you can get 10 high-resolution images for as little as $25 — a mere $2.50 per image. Needing to do more with your pictures? The Extended option license allows for unlimited printed reproductions as well as outdoor advertising. Unlike the Standard plan, you can also use your downloads on products for sale or distribution, digital templates for sale or distribution, and designs for a business or commercial space.