Decorative makeup products on color background
Stock Photo ID: 172351
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Decorative makeup products on color background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 26 Jan 2018
You may use our image “Decorative makeup products on color background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
accessoryartistbackgroundbeautycarecollectioncolorcompositioncopycosmeticcosmetologycurlerdecorativedesigndifferenteyeeyelashfacialfashionflatframeitemskitlaylipstickmacaronmakemake-upmakeupnailnobodyobjectpolishproductsprofessionalsetshadowskinspacestyletexttoolstoptrendtrendyturquoiseupviewvisagevogue
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Safeguard your business with our royalty-free licensed visuals
As a reputed supplier of high-quality stock photography, business owners have peace of mind when it comes to sourcing and downloading licensed visuals from our site. Regardless of what you need photo content for, there are unlimited options for the pictures you get. As well as being high-resolution and versatile for promotional activities such as marketing, advertising, social media, and web design, our pictures promote responsible image use and will leave a lasting impact not only on your audience but also in licensing on the digital and traditional landscape. Discover today how your image choices will leave a positive legacy.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Business owners love our photo stock for the purchasing experience
We are a trusted supplier of stock images because we offer our users an efficient and enjoyable experience when using our platform. This, combined with payment protection and cost-effective pricing plans, means that you get a full suite of features and benefits that you likely won’t find with other providers. From browsing to selecting, purchasing, downloading, and using your new images, it only takes a matter of minutes from start to finish. Review our license comparison summary for what is allowed and included with each package so you know whether our Standard or Extended options are best for your creative requirements.