Decorative cosmetics for kids. Eye shadow palette, lipsticks, accessories and flowers on white wooden table, closeup
Stock Photo ID: 1287648
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Decorative cosmetics for kids. Eye shadow palette, lipsticks, accessories and flowers on white wooden table, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 17 Apr 2023
You may use our image “Decorative cosmetics for kids. Eye shadow palette, lipsticks, accessories and flowers on white wooden table, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
accessoriesadorablebackgroundbeautifulbeautybrightcarechildchildhoodchildrencloseupcolorcolorfulcosmeticcosmeticscutedecorativedesigneyeeyeshadowsfacefacialfashionflowersfungirlglamourhobbykidkitlifestyleliplipsticklipstickslittlemakemakeupobjectpaintpaletteplaypretendproductsalonshadowstylishtableupwhitewooden
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Transform your projects with creative imagery collections
Enhance your creative work with a huge collection of stock images that more than stand out from the crowd. There are a number of thematic categories, depending on whether you are looking for ordinary, everyday lifestyle pictures or something a little more different and unique. Regularly updated to stay current and relevant, our engaging image collections showcase modern and trending photos, including interior designs, happy families, holidays, fresh foods, and more; only the best visuals are selected and made available on the platform. With this high-quality photo stock, every picture can transform uninspiring and plain creatives to compelling visual stories.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a pleasant shopping experience on our easy-to-use site
Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.