
Cute little girl wearing flower wreath outdoors, space for text. Child spending time in nature
Stock Photo ID: 602006
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Cute little girl wearing flower wreath outdoors, space for text. Child spending time in nature”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 29 Jul 2020
You may use our image “Cute little girl wearing flower wreath outdoors, space for text. Child spending time in nature” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
activeadorablebackgroundbeautifulcaucasiancheerfulchildchildhoodcopycountrycountrysidecrowncutedayenjoyenvironmentfieldflorafloralflowerflowersfreedomgirlhappyjoykidlandscapelifestylelittlemeadownatureoutdoorsoutsidepersonplayprimaryschoolseasonsmilingspacespendingspringsummersummertimetexttimewearingwildwildflowerwreath
Africa Images: your destination for creative visuals
Africa Images, owned by Africa Studio, is dedicated to offering the newest and widest range of high-quality stock pictures. With all types and subcategories of images, such as hygiene products and interiors, it is easy to find what you are looking for in our vast photo collections. Our “Featured collections” gallery is home to the latest trending and popular photos and is an excellent source of inspiration for your advertising and marketing campaigns. Content creators and business owners can not only boost their sales, but also increase their visibility in the market thanks to the bonus features and benefits on offer, including free images, previews, and unlimited downloads.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
The purchasing experience on our stock image platform is a standout
To keep customers happy in a competitive marketplace, we understand that their online experience must be seamless. This is why we have an intuitive website, designed and tailored to meet our users’ specific needs. From start to finish, the process of finding, purchasing, and downloading your chosen images is simple regardless of whether you’re coming to the site with an exact image in mind or with a creative idea to explore in more detail. Our handy license comparison summary will help you understand which type of on-demand pack you require (Standard or Extended) based on the image use and agreement terms.