![Cute little children with gift boxes near Christmas tree at home Photo of Cute little children with gift boxes near Christmas tree at home](https://static.africaimages.com/photos/H/P/HPJkVGXztZA2nhnR0CVBmjmFS/HPJkVGXztZA2nhnR0CVBmjmFS_normal.jpg)
Cute little children with gift boxes near Christmas tree at home
Stock Photo ID: 858401
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Cute little children with gift boxes near Christmas tree at home”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 13 Dec 2021
You may use our image “Cute little children with gift boxes near Christmas tree at home” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adorablebackgroundblurredboxesboybrothercarpetcaucasiancelebrationchildrenchristmascutedecemberdecordecorationeveeveningfamilyfestivefloorfriendsfungiftgirlhappyholidayhomeindoorskidslightslittlelivingmagicmerrynewopeningpajamaspeoplepresentprimaryroomschoolsistersittingsmilingtraditiontreewinterxmasyear
Africa Images: where quality and creativity come together in harmony
Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.
Let us provide royalty-free visual investments for your brand
High-resolution stock photos exist so that content creators and businesses can easily find an image that’s already available, offering convenience and saving time, resources, and money. Once an image is downloaded from the website, you will have access to it immediately, which means no waiting for post-production editing before you can start to use your photo. This is just one of the many features and benefits of our service to elevate your brand’s creative output and appeal. These royalty-free photos are an invaluable resource and investment for designers, business owners, teachers, bloggers, and marketers wanting to produce high-quality, professional content.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.