![Cough drops, fresh lemon and honey on light blue background Photo of Cough drops, fresh lemon and honey on light blue background](https://static.africaimages.com/photos/v/5/v5uKVWWmzAUVKGg7oe0hFA6Gp/v5uKVWWmzAUVKGg7oe0hFA6Gp_normal.jpg)
Cough drops, fresh lemon and honey on light blue background
Stock Photo ID: 1167361
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Cough drops, fresh lemon and honey on light blue background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 Jan 2023
You may use our image “Cough drops, fresh lemon and honey on light blue background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
addictionanestheticapothecarybackgroundbluecandycarecoldcolorcoughcurediseasedropsdrugeatfeverflavorflufoodfreshfruithealhealthhoneyillnesslemonlightlozengemedicationmedicinementholnaturalobjectoralpastillepharmacypillsprescriptionreliefremedyshapesicksicknesssoresugarsweetsymptomsthroattreatmentvitamin
Africa Images: stay relevant and up to date with the latest trends
At Africa Images, we pride ourselves on offering content creators the latest and most unique stock photos and visual services. Our daily updated image collections, which include trending and popular materials, are ideal for both commercial and non-commercial projects. If you are in marketing, advertising, or communications, these royalty-free pictures can improve your campaigns by raising brand awareness and driving sales. By monitoring and staying up to date with the latest trends, and offering a range of sizes and resolutions, we guarantee that with our distinct images, your company will stand out from its competitors and leave a lasting impression on your audience.
Discover how pictures can drive brand engagement and loyalty
When done professionally and with purpose, images can drive significant engagement and brand recognition for your business. The lasting presence of an image can enhance a piece of content’s reach while also keeping it alive in the reader’s mind. Investing in high-quality, royalty-free images could be different between potential customers choosing your brand over competitors. If you want your campaign or next piece of content to drive maximum impact and be faster and more effective, our photo stock will enable you to create impressive visual strategies. You can trust in our professional photography to enhance your advertisement campaigns or promotions.
Create magic with our expansive stock photography collections
Our varied range of image categories — from everyday scenes to highly specialized subjects — will keep you up to date with the latest visual and popular trends. With millions of images available on the platform, we are dedicated to offering the best possible royalty-free photos that meet the highest standards. In our regularly updated collections, you will see nothing but exceptional, beautiful pictures. Examine new trends in home interiors, salons, spas, businesses, and drinks, whose every category highlights the evolving landscape of visual storytelling. From A to Z, you will easily find the right images that reflect your brand vision and enhance your projects.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Experience a buying journey like no other with our photo stock
Our website offers a slick user experience for ease and speed when browsing our vast collection of images so that you can concentrate on finding the perfect visuals for your projects without any obstacles. A review of our useful comparison table will outline what the Standard and Extended licenses can be used for when it comes to content creation, enabling you to choose what works best for you or your business. With one Standard high-resolution image costing a budget-friendly $5, it’s worth investing in 10 for only $25 to get a bulk saving and more pictures banked for your upcoming initiatives.