
Cosmetology. Medical syringe and freesia flower on turquoise background
Stock Photo ID: 1644248
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Cosmetology. Medical syringe and freesia flower on turquoise background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 15 Feb 2024
You may use our image “Cosmetology. Medical syringe and freesia flower on turquoise background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
artbackgroundbeautifulbeautycarecleancliniccloseupcollagencolorconceptcosmeticcosmetologycreativecuredesigndiseasedoctordrugflowerfreesiahealthillnessinjectinjectionlablaboratorymedicalmedicamentmedicineneedlenobodyobjectpharmacysafetyscienceserviceshotsicknessspringsummersyringetherapytransparenttreatmentturquoisevaccinationviruswellbeingwellness
Africa Images: the ultimate destination for royalty-free stock photos
Africa Images produces high-quality stock imagery designed to enhance your marketing and advertising endeavors. A detailed process is followed by our expert team before any image is posted on our website, including researching trending and popular materials. Our team of professionals arranges everything you can see in our high-resolution photos, including furniture, food, and technology. With a varied collection covering everything from Christmas to pregnancy and transportation, as well as a range of sizes and resolutions available, there’s a suitable image for all requirements. We offer cost-effective and royalty-free stock photography that will make your brand stand out from the crowd.
Let your content showcase the emotive power of stock images
Content building is one of the most important aspects of today’s marketing and communication in an almost exclusively digital world. Regardless of the type of content, whether it is social media posts, blog posts, website content or even presentations, the visual impact of these materials is crucial to gain the audience’s attention. With time, stock photos have increased in popularity, becoming an effective way of improving the quality and power of content, as well as being educational, engaging, and entertaining. We have images to suit the visual style of your brand, helping to create the desired emotions and response from your target audience.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.